Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Glucocorticoid receptor (NR3C1) . Accession Number: P04150; NR3C1. Expression Region: 521-777aa. Tag Info: N-terminal 10xHis-GST-tagged. Theoretical MW: 61.3kda. Target Synonyms: Nuclear receptor subfamily 3 group C member 1 GRL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein.

Accession Number

P04150; NR3C1

Expression Region

521-777aa

Host

E. coli

Target

Glucocorticoid receptor (NR3C1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nuclear receptor subfamily 3 group C member 1 GRL

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Cell cycle serine/threonine-protein kinase hsk1 (hsk1), partial
MBS1233940 Inquire

Recombinant Schizosaccharomyces pombe Cell cycle serine/threonine-protein kinase hsk1 (hsk1), partial

Sign In for Pricing
View Details
RP-64477 25mg
A21108-25 25 mg

RP-64477 25mg

Sign In for Pricing
View Details
PCTAIRE3 (CDK18) (NM_212503) Human Tagged Lenti ORF Clone
RC215371L4 10 µg

PCTAIRE3 (CDK18) (NM_212503) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GDF10 Polyclonal Antibody, RBITC Conjugated
bs-5720R-RBITC 100 µL

GDF10 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Polyclonal TGF-beta2 Antibody
APR10402G 0.1mg

Polyclonal TGF-beta2 Antibody

Sign In for Pricing
View Details
Cd1d2 Mouse shRNA Plasmid (Locus ID 12480)
TR500304 1 Kit

Cd1d2 Mouse shRNA Plasmid (Locus ID 12480)

Sign In for Pricing
View Details