Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Glucocorticoid receptor (NR3C1) . Accession Number: P04150; NR3C1. Expression Region: 521-777aa. Tag Info: N-terminal 10xHis-GST-tagged. Theoretical MW: 61.3kda. Target Synonyms: Nuclear receptor subfamily 3 group C member 1 GRL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein.

Accession Number

P04150; NR3C1

Expression Region

521-777aa

Host

E. coli

Target

Glucocorticoid receptor (NR3C1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-GST-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nuclear receptor subfamily 3 group C member 1 GRL

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF512 AAV Vector (Human) (CMV)
51575101 1 µg

ZNF512 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
NAP1L2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11172R-APC-Cy5.5 100 µL

NAP1L2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Probable GTP pyrophosphokinase (relA), partial
MBS1429284 Inquire

Recombinant Mycobacterium leprae Probable GTP pyrophosphokinase (relA), partial

Sign In for Pricing
View Details
COX-2 polyclonal antibody
BML-SA237-0100 100 µg

COX-2 polyclonal antibody

Sign In for Pricing
View Details
Hydrocortisone Acetate Impurity 2
RM-H040325-01 10 mg

Hydrocortisone Acetate Impurity 2

Sign In for Pricing
View Details
Hydrocortisone Acetate Impurity 2
RM-H040325-02 25 mg

Hydrocortisone Acetate Impurity 2

Sign In for Pricing
View Details