Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G1/S-specific cyclin-D2 (CCND2)

Recombinant Human G1/S-specific cyclin-D2 (CCND2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: G1/S-specific cyclin-D2 (CCND2) . Accession Number: P30279; CCND2. Expression Region: 1-289aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 60.1kda. Target Synonyms: CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human G1/S-specific cyclin-D2 (CCND2) is a purified Recombinant Protein.

Accession Number

P30279; CCND2

Expression Region

1-289aa

Host

E. coli

Target

G1/S-specific cyclin-D2 (CCND2)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

60.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX32 Polyclonal Antibody
31415-01 50 µL

SNX32 Polyclonal Antibody

Sign In for Pricing
View Details
SNX32 Polyclonal Antibody
31415-02 100 µL

SNX32 Polyclonal Antibody

Sign In for Pricing
View Details
CPS1 Antibody
orb2638328 100 µg

CPS1 Antibody

Sign In for Pricing
View Details
ELISA Kit For Ubiquitin carboxyl-terminal hydrolase 42
E6525m 96 Tests

ELISA Kit For Ubiquitin carboxyl-terminal hydrolase 42

Sign In for Pricing
View Details
Rabbit cross linked C-telopeptide of type II collagen, CTX-II ELISA Kit
MBS705896-01 24 Well (LIMIT 1)

Rabbit cross linked C-telopeptide of type II collagen, CTX-II ELISA Kit

Sign In for Pricing
View Details
Rabbit cross linked C-telopeptide of type II collagen, CTX-II ELISA Kit
MBS705896-02 48 Well

Rabbit cross linked C-telopeptide of type II collagen, CTX-II ELISA Kit

Sign In for Pricing
View Details