Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G1/S-specific cyclin-D2 (CCND2)

Recombinant Human G1/S-specific cyclin-D2 (CCND2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: G1/S-specific cyclin-D2 (CCND2) . Accession Number: P30279; CCND2. Expression Region: 1-289aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 60.1kda. Target Synonyms: CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human G1/S-specific cyclin-D2 (CCND2) is a purified Recombinant Protein.

Accession Number

P30279; CCND2

Expression Region

1-289aa

Host

E. coli

Target

G1/S-specific cyclin-D2 (CCND2)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

60.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC88 Adenovirus (Human)
36828051 1.0 mL

PIRC88 Adenovirus (Human)

Sign In for Pricing
View Details
Cdc42ep1 Rat shRNA Lentiviral Particle (Locus ID 315121)
TL703961V 500 µL Each

Cdc42ep1 Rat shRNA Lentiviral Particle (Locus ID 315121)

Sign In for Pricing
View Details
Lentiviral mouse Zfp839 shRNA (UAS) - Lentiviral mouse Zfp839 shRNA (UAS, iRFP) (25)
GTR15270350 1 Vial

Lentiviral mouse Zfp839 shRNA (UAS) - Lentiviral mouse Zfp839 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TMPO sgRNA CRISPR Lentivector (Human) (Target 3)
K2409904 1.0 µg DNA

TMPO sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Bovine v-ets erythroblastosis virus E26 oncogene homolog 2 (avian) ELISA Kit
OM624224 96 Strip Well

Bovine v-ets erythroblastosis virus E26 oncogene homolog 2 (avian) ELISA Kit

Sign In for Pricing
View Details
MEK1, MEK2, phosphorylated (Ser218/222) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (Biotin) discontinued
M2865-03B-Biotin 100 µL

MEK1, MEK2, phosphorylated (Ser218/222) (MAPK/ERK Kinase 1, MEK 1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAP2K1, MAPKK 1, MKK1, PRKMK1, ERK Activator Kinase 1 / MAPK/ERK Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, MAP Kinase Kinase 2, MAP2K2, MAPKK 2, MKK2, PRKMK2, ERK Activator Kinase 2) (Biotin) discontinued

Sign In for Pricing
View Details