Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), partial

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) . Accession Number: Q8N423; LILRB2. Expression Region: 22-460aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 55.1kda. Target Synonyms: LIR-2; Leukocyte immunoglobulin-like receptor 2; CD85 antigen-like family member D; Immunoglobulin-like transcript 4; ILT-4; Monocyte/macrophage immunoglobulin-like receptor 10; MIR-10; CD antigen CD85d Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), partial is a purified Recombinant Protein.

Accession Number

Q8N423; LILRB2

Expression Region

22-460aa

Host

E. coli

Target

Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LIR-2; Leukocyte immunoglobulin-like receptor 2; CD85 antigen-like family member D; Immunoglobulin-like transcript 4; ILT-4; Monocyte/macrophage immunoglobulin-like receptor 10; MIR-10; CD antigen CD85d

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tdrd3 qPCR Primer Pair
QM56870S 200 Tests

Mouse Tdrd3 qPCR Primer Pair

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS605259 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Ago4 antibody (pAb)
MBS388588-01 0.01 mL

Ago4 antibody (pAb)

Sign In for Pricing
View Details
Ago4 antibody (pAb)
MBS388588-02 0.1 mL

Ago4 antibody (pAb)

Sign In for Pricing
View Details
Ago4 antibody (pAb)
MBS388588-03 5x 0.1 mL

Ago4 antibody (pAb)

Sign In for Pricing
View Details
Lentiviral human ST13 sgRNA gene knockout kit - Lentiviral human ST13 sgRNA gene knockout kit (plasmid)
GTR15367622 1 Vial

Lentiviral human ST13 sgRNA gene knockout kit - Lentiviral human ST13 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details