Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Methylosome subunit pICln (CLNS1A)

Recombinant Rabbit Methylosome subunit pICln (CLNS1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: Methylosome subunit pICln (CLNS1A) . Accession Number: Q28678; CLNS1A. Expression Region: 2-236aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.4kda. Target Synonyms: Chloride channel; nucleotide sensitive 1A; Chloride conductance regulatory protein ICln; I (Cln Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rabbit Methylosome subunit pICln (CLNS1A) is a purified Recombinant Protein.

Accession Number

Q28678; CLNS1A

Expression Region

2-236aa

Host

E. coli

Target

Methylosome subunit pICln (CLNS1A)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Chloride channel; nucleotide sensitive 1A; Chloride conductance regulatory protein ICln; I (Cln

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

SFLKSFPPPGPTEGLRHQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant GP1BB protein
PROTP13224-250ug 250 µg

Human recombinant GP1BB protein

Sign In for Pricing
View Details
PAQR6 sgRNA CRISPR Lentivector (Human) (Target 2)
K1593603 1.0 µg DNA

PAQR6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Charged Multivesicular Body Protein 2a (CHMP2A) Antibody
abx231658 100 µg

Charged Multivesicular Body Protein 2a (CHMP2A) Antibody

Sign In for Pricing
View Details
Human ADAT2 Pre-designed siRNA Set B
SI000302B 1 Each

Human ADAT2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Brucella Abortus folE Protein (strain 2308) (aa 1-213)
VAng-Lsx5318-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus folE Protein (strain 2308) (aa 1-213)

Sign In for Pricing
View Details
Mouse Monoclonal Sarcalumenin Antibody (XIIC4) [Alexa Fluor 532]
NB120-2874AF532 0.1 mL

Mouse Monoclonal Sarcalumenin Antibody (XIIC4) [Alexa Fluor 532]

Sign In for Pricing
View Details