Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Sphingomyelinase C 2 (sph2), partial

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Sphingomyelinase C 2 (sph2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) . Target Name: Sphingomyelinase C 2 (sph2) . Accession Number: P59116; sph2. Expression Region: 158-433aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 39.3kda. Target Synonyms: Sphingomyelin phosphodiesterase 2; SMase 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Sphingomyelinase C 2 (sph2), partial is a purified Recombinant Protein.

Accession Number

P59116; sph2

Expression Region

158-433aa

Host

E. coli

Target

Sphingomyelinase C 2 (sph2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Sphingomyelin phosphodiesterase 2; SMase 2

Species

Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

Protein Name

Recombinant Protein

AA Sequence

LSHNVFMLPTNLPRWGNLGHDERAKRISKSDYVKNQDVIVFEEAFDTSARKILLDNLREEYPYQTDVVGRTKKNWDASLGNFRSYSLVNGGVVILSKWPIEEKIQYIFNDSGCGADWFANKGFVYVKINKEGKKFHVIGTHAQSQDQNCSNLGIPNRANQFDDIRNFIYSKNIPKDETVLIVGDLNVIKESNEYYDMISRLNVNEPRYVGVPFTWDAKTNEIAAYYYENEEPVYLDYIFVSKSHAQPPVWQNLAYDPVSKQTWTVSGYTSDEFSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details