Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage H19B (Bacteriophage H19B) . Target Name: Shiga-like toxin 1 subunit B (stxB) . Accession Number: P69179; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 23.7kda. Target Synonyms: Verocytotoxin 1 subunit B; Verotoxin 1 subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) is a purified Recombinant Protein.

Accession Number

P69179; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga-like toxin 1 subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Verocytotoxin 1 subunit B; Verotoxin 1 subunit B

Species

Enterobacteria phage H19B (Bacteriophage H19B)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-100 1x 100 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF647 conjugate, 0.1mg/mL
BNC471951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL
BNC682983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF594 conjugate, 0.1mg/mL
BNC942398-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2398), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details