Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus 1A Genome polyprotein, partial

Recombinant Human rhinovirus 1A Genome polyprotein, partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human rhinovirus 1A (HRV-1A) . Target Name: rhinovirus 1A Genome polyprotein. Accession Number: P23008; N/A. Expression Region: 571-857aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 45.5kda. Target Synonyms: VP4-VP2; P1A; Virion protein 4; P1B; Virion protein 2; P1C; Virion protein 3; P1D; Virion protein 1; P2A; Picornain 2A; Protein 2A; P2B; P2C; P3A; VPg; Protein 3B; P3B; Picornain 3C; P3C; RdRp; 3D polymerase; 3Dpol; Protein 3D; 3D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human rhinovirus 1A Genome polyprotein, partial is a purified Recombinant Protein.

Accession Number

P23008; N/A

Expression Region

571-857aa

Host

E. coli

Target

Rhinovirus 1A Genome polyprotein

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

VP4-VP2; P1A; Virion protein 4; P1B; Virion protein 2; P1C; Virion protein 3; P1D; Virion protein 1; P2A; Picornain 2A; Protein 2A; P2B; P2C; P3A; VPg; Protein 3B; P3B; Picornain 3C; P3C; RdRp; 3D polymerase; 3Dpol; Protein 3D; 3D

Species

Human rhinovirus 1A (HRV-1A)

Protein Name

Recombinant Protein

AA Sequence

NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)
abx335892-01 20 µg

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)

Sign In for Pricing
View Details
Growth Differentiation Factor 7 (GDF7) Antibody (HRP)
abx335892-02 50 µg

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)

Sign In for Pricing
View Details
Growth Differentiation Factor 7 (GDF7) Antibody (HRP)
abx335892-03 100 µg

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)

Sign In for Pricing
View Details
Growth Differentiation Factor 7 (GDF7) Antibody (HRP)
abx335892-04 200 µg

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)

Sign In for Pricing
View Details
Growth Differentiation Factor 7 (GDF7) Antibody (HRP)
abx335892-05 1 mg

Growth Differentiation Factor 7 (GDF7) Antibody (HRP)

Sign In for Pricing
View Details
MAGEB18 Mouse Monoclonal Antibody [Clone ID: LBI1F5]
AMM10951V 100 µL

MAGEB18 Mouse Monoclonal Antibody [Clone ID: LBI1F5]

Sign In for Pricing
View Details