Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD9 antigen (CD9), partial

Recombinant Human CD9 antigen (CD9), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD9 antigen (CD9) . Accession Number: P21926; CD9. Expression Region: 112-195aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.1kda. Target Synonyms: 5H9 antigen; Cell growth-inhibiting gene 2 protein; Leukocyte antigen MIC3; Motility-related protein; MRP-1; Tetraspanin-29; Tspan-29; p24; CD antigen CD9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human CD9 antigen (CD9), partial is a purified Recombinant Protein.

Accession Number

P21926; CD9

Expression Region

112-195aa

Host

E. coli

Target

CD9 antigen (CD9)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

5H9 antigen; Cell growth-inhibiting gene 2 protein; Leukocyte antigen MIC3; Motility-related protein; MRP-1; Tetraspanin-29; Tspan-29; p24; CD antigen CD9

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
13858111 3x 1.0 µg

C14orf45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
3-Methylpyridine 1-oxide
orb3023273-01 50 mg

3-Methylpyridine 1-oxide

Sign In for Pricing
View Details
3-Methylpyridine 1-oxide
orb3023273-02 100 mg

3-Methylpyridine 1-oxide

Sign In for Pricing
View Details
ReadiCleave™ XFD532 SSL-NHS ester
7051-AAT 1 mg

ReadiCleave™ XFD532 SSL-NHS ester

Sign In for Pricing
View Details
STAU2 Rabbit Polyclonal Antibody
orb631579-01 50 µg

STAU2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAU2 Rabbit Polyclonal Antibody
orb631579-02 100 µg

STAU2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details