Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-4 (Lgals4)

Recombinant Mouse Galectin-4 (Lgals4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Galectin-4 (Lgals4) . Accession Number: Q8K419; Lgals4. Expression Region: 1-326aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 38.4kda. Target Synonyms: Gal-4; Lactose-binding lectin 4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Galectin-4 (Lgals4) is a purified Recombinant Protein.

Accession Number

Q8K419; Lgals4

Expression Region

1-326aa

Host

Yeast

Target

Galectin-4 (Lgals4)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gal-4; Lactose-binding lectin 4

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nlrp6 (BC031139) Mouse Untagged Clone
MC218117 10 µg

Nlrp6 (BC031139) Mouse Untagged Clone

Sign In for Pricing
View Details
XS Protein Lysate (Human) with C-Ha Tag
50574031 100 µg

XS Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rosa Roxburghii Root Extract
E3113-5mg 5 mg

Rosa Roxburghii Root Extract

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila rimP Protein
VAng-Lsx0924-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila rimP Protein

Sign In for Pricing
View Details
Human Tyrosine protein phosphatase non receptor type 1 (PTPN1) ELISA Kit
MBS7227606-01 48 Well

Human Tyrosine protein phosphatase non receptor type 1 (PTPN1) ELISA Kit

Sign In for Pricing
View Details
Human Tyrosine protein phosphatase non receptor type 1 (PTPN1) ELISA Kit
MBS7227606-02 96 Well

Human Tyrosine protein phosphatase non receptor type 1 (PTPN1) ELISA Kit

Sign In for Pricing
View Details