Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adipocyte plasma membrane-associated protein (Apmap), partial

Recombinant Mouse Adipocyte plasma membrane-associated protein (Apmap), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Adipocyte plasma membrane-associated protein (Apmap) . Accession Number: Q9D7N9; Apmap. Expression Region: 61-415aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 47.3kda. Target Synonyms: Protein DD16 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Adipocyte plasma membrane-associated protein (Apmap), partial is a purified Recombinant Protein.

Accession Number

Q9D7N9; Apmap

Expression Region

61-415aa

Host

E. coli

Target

Adipocyte plasma membrane-associated protein (Apmap)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein DD16

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit
MBS9940176-01 48 Well

Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit

Sign In for Pricing
View Details
Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit
MBS9940176-02 96 Well

Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit

Sign In for Pricing
View Details
Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit
MBS9940176-03 5x 96 Well

Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit

Sign In for Pricing
View Details
Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit
MBS9940176-04 10x 96 Well

Sheep UDP-Glucuronosyltransferase 3A2 (UGT3A2) ELISA Kit

Sign In for Pricing
View Details
Anti-Integrin beta 5/ITGB5 Antibody Picoband® (monoclonal, 9E2) Fluoro594 Conjugated
M04201-Fluoro594 100 µg/Vial

Anti-Integrin beta 5/ITGB5 Antibody Picoband® (monoclonal, 9E2) Fluoro594 Conjugated

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS804233 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details