Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Granzyme A (Gzma) . Accession Number: P11032; Gzma. Expression Region: 29-260aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 31.6kda. Target Synonyms: Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1; TSP-1; Ctla-3; Ctla3; Mtsp-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Granzyme A (Gzma) is a purified Recombinant Protein.

Accession Number

P11032; Gzma

Expression Region

29-260aa

Host

E. coli

Target

Granzyme A (Gzma)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1; TSP-1; Ctla-3; Ctla3; Mtsp-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament NF-L Antibody
orb175914 100 µL

Neurofilament NF-L Antibody

Sign In for Pricing
View Details
SPN, ID (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750) discontinued
042241-ML750 100 µL

SPN, ID (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PRSS2 polyclonal antibody
orb646169-01 50 μL

PRSS2 polyclonal antibody

Sign In for Pricing
View Details
PRSS2 polyclonal antibody
orb646169-02 100 µL

PRSS2 polyclonal antibody

Sign In for Pricing
View Details
PRSS2 polyclonal antibody
orb646169-03 200 µL

PRSS2 polyclonal antibody

Sign In for Pricing
View Details
Mouse Platelet Factor 4 (PF-4) ELISA Kit
AE27936MO-01 48 Tests

Mouse Platelet Factor 4 (PF-4) ELISA Kit

Sign In for Pricing
View Details