Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear receptor corepressor 1 (NCOR1), partial

Recombinant Human Nuclear receptor corepressor 1 (NCOR1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Nuclear receptor corepressor 1 (NCOR1) . Accession Number: O75376; NCOR1. Expression Region: 1-373aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 48.3kda. Target Synonyms: N-CoR; N-CoR1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Nuclear receptor corepressor 1 (NCOR1), partial is a purified Recombinant Protein.

Accession Number

O75376; NCOR1

Expression Region

1-373aa

Host

E. coli

Target

Nuclear receptor corepressor 1 (NCOR1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

N-CoR; N-CoR1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H3A Antibody (Phospho-Thr11)
OAAN02759-50UL 50 µL

HIST1H3A Antibody (Phospho-Thr11)

Sign In for Pricing
View Details
CYCS Monoclonal Antibody
E53M01944 100 µL

CYCS Monoclonal Antibody

Sign In for Pricing
View Details
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta) (FITC) discontinued
I7661-39L3 100 µg

Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla, ITGB1, Fibrinogen Receptor beta Subunit, FNRB, Integrin VLA4 Subunit beta, MDF2, MSK12, Very Late Activation Protein beta Polypeptide, VLAB, VLAbeta) (FITC) discontinued

Sign In for Pricing
View Details
Anti-ZNF493 Antibody
CQA6696-01 30 µL

Anti-ZNF493 Antibody

Sign In for Pricing
View Details
Anti-ZNF493 Antibody
CQA6696-02 50 μL

Anti-ZNF493 Antibody

Sign In for Pricing
View Details
Anti-ZNF493 Antibody
CQA6696-03 100 µL

Anti-ZNF493 Antibody

Sign In for Pricing
View Details