Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-1 (RSPO1), Active Protein

Recombinant Human R-spondin-1 (RSPO1), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: R-spondin-1 (RSPO1) . Accession Number: Q2MKA7; R-Spondin1. Expression Region: 21-263aa. Tag Info: Tag-Free. Theoretical MW: 26.7kda. Target Synonyms: RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human R-spondin-1 (RSPO1), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q2MKA7; R-Spondin1

Expression Region

21-263aa

Host

Mammalian Cells

Target

R-spondin-1 (RSPO1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNAzol® BD Column Kit
RC 292 50 Isolations

RNAzol® BD Column Kit

Sign In for Pricing
View Details
Ki67/MKI67 Rabbit Polyclonal Antibody (FITC)
orb2574071 100 µg

Ki67/MKI67 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Prss35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3697208 1.0 µg DNA

Prss35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
UNC13C Protein Vector (Mouse) (pPB-C-His)
PV244158 500 ng

UNC13C Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
C2orf52 Protein Vector (Human) (pPM-C-His)
PV006232 500 ng

C2orf52 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (HRP) discontinued
C2259-07-HRP 200 µL

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (HRP) discontinued

Sign In for Pricing
View Details