Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Noggin (NOG), Active Protein

Recombinant Human Noggin (NOG), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Noggin (NOG) . Accession Number: Q13253; Noggin. Expression Region: 28-232aa. Tag Info: Tag-Free. Theoretical MW: 23kda. Target Synonyms: Noggin; NOG Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Noggin (NOG), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q13253; Noggin

Expression Region

28-232aa

Host

Mammalian Cells

Target

Noggin (NOG)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Noggin; NOG

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Stag1 shRNA (UAS) - Lentiviral mouse Stag1 shRNA (UAS) (100)
GTR15198078 1 Vial

Lentiviral mouse Stag1 shRNA (UAS) - Lentiviral mouse Stag1 shRNA (UAS) (100)

Sign In for Pricing
View Details
CHN 1 (CHN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A1]
TA505096AM 100 µL

CHN 1 (CHN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A1]

Sign In for Pricing
View Details
Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit
MBS2707547-01 24 Strip Well

Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit

Sign In for Pricing
View Details
Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit
MBS2707547-02 48 Strip Well

Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit

Sign In for Pricing
View Details
Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit
MBS2707547-03 96 Strip Well

Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit

Sign In for Pricing
View Details
Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit
MBS2707547-04 5x 96 Strip Well

Rat Malonyl Coenzyme A Decarboxylase (MLYCD) ELISA Kit

Sign In for Pricing
View Details