Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA), Active Protein

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Vascular endothelial growth factor A, long form (VEGFA) . Accession Number: P15692-4; VEGF165 (His Tag) . Expression Region: 27-191aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 20kda. Target Synonyms: Vascular Endothelial Growth Factor Isoform 165; VEGF165 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA), Active Protein is a purified Active Recombinant Protein.

Accession Number

P15692-4; VEGF165 (His Tag)

Expression Region

27-191aa

Host

Mammalian Cells

Target

Vascular endothelial growth factor A, long form (VEGFA)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein of Isoform VEGF165

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vascular Endothelial Growth Factor Isoform 165; VEGF165

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Cbl (phospho-Tyr700) Antibody
ABM0426 100 µL

C-Cbl (phospho-Tyr700) Antibody

Sign In for Pricing
View Details
RACGAP1 Polyclonal Antibody, PE Conjugated
bs-7766R-PE 100 µL

RACGAP1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)
MBS1113265-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)
MBS1113265-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)
MBS1113265-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)
MBS1113265-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00430/AtMg01150 (AtMg00430)

Sign In for Pricing
View Details