Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-7 (IL7), Active Protein

Recombinant Human Interleukin-7 (IL7), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-7 (IL7) . Accession Number: P13232; IL-7. Expression Region: 26-177aa. Tag Info: Tag-Free. Theoretical MW: 17.3kda. Target Synonyms: Interleukin-7; IL-7; IL7 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-7 (IL7), Active Protein is a purified Active Recombinant Protein.

Accession Number

P13232; IL-7

Expression Region

26-177aa

Host

Mammalian Cells

Target

Interleukin-7 (IL7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-7; IL-7; IL7

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gspt1 (NM_001003978) Rat Tagged Lenti ORF Clone
RR215669L3 10 µg

Gspt1 (NM_001003978) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human LRRC18 shRNA (UAS) - Lentiviral human LRRC18 shRNA (UAS) (100)
GTR15313269 1 Vial

Lentiviral human LRRC18 shRNA (UAS) - Lentiviral human LRRC18 shRNA (UAS) (100)

Sign In for Pricing
View Details
RNASE4 ORF Vector (Human) (pORF)
40202011 1.0 µg DNA

RNASE4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TFF2 Protein Vector (Mouse) (pPM-C-HA)
46574024 500 ng

TFF2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CD105, ID (E395) (ENG, END, Endoglin, CD105) (MaxLight 490) discontinued
033445-ML490 100 µL

CD105, ID (E395) (ENG, END, Endoglin, CD105) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Flotillin 2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61102R-BF594-01 20 µL

Flotillin 2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details