Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3), Active Protein

Recombinant Human Interleukin-3 (IL3), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-3 (IL3) . Accession Number: P08700; IL-3. Expression Region: 20-152aa. Tag Info: Tag-Free. Theoretical MW: 15kda. Target Synonyms: Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-3 (IL3), Active Protein is a purified Active Recombinant Protein.

Accession Number

P08700; IL-3

Expression Region

20-152aa

Host

Mammalian Cells

Target

Interleukin-3 (IL3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-01 10 µg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details
Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-02 50 µg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details
Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-03 100 µg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details
Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-04 200 µg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details
Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-05 500 µg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details
Recombinant Polymerase DNA Directed Delta 1 (POLd)
TRV-0038219-06 1 mg

Recombinant Polymerase DNA Directed Delta 1 (POLd)

Sign In for Pricing
View Details