Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 4 (FGF4) . Accession Number: P08620; FGF-4. Expression Region: 31-206aa. Tag Info: Tag-Free. Theoretical MW: 19.3kda. Target Synonyms: Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein is a purified Active Recombinant Protein.

Accession Number

P08620; FGF-4

Expression Region

31-206aa

Host

Mammalian Cells

Target

Fibroblast growth factor 4 (FGF4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 1 Antibody (KRT1/1840) [PerCP]
NBP3-08475PCP 0.1 mL

Mouse Monoclonal Cytokeratin 1 Antibody (KRT1/1840) [PerCP]

Sign In for Pricing
View Details
MTF1 Rabbit Polyclonal Antibody (Carrier-free)
orb3105075 100 µg

MTF1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Recombinant Human GDF-7/BMP-12
P5787-500μg 500 µg

Recombinant Human GDF-7/BMP-12

Sign In for Pricing
View Details
CTSH Antibody
A18510-100UL 100 µL

CTSH Antibody

Sign In for Pricing
View Details
COQ6 shRNA Plasmid (m)
sc-142514-SH 20 µg

COQ6 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal FAIM3 Antibody (992338) [mFluor Violet 500 SE]
FAB9494MFV500 0.1 mL

Mouse Monoclonal FAIM3 Antibody (992338) [mFluor Violet 500 SE]

Sign In for Pricing
View Details