Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 4 (FGF4) . Accession Number: P08620; FGF-4. Expression Region: 31-206aa. Tag Info: Tag-Free. Theoretical MW: 19.3kda. Target Synonyms: Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 4 (FGF4), Active Protein is a purified Active Recombinant Protein.

Accession Number

P08620; FGF-4

Expression Region

31-206aa

Host

Mammalian Cells

Target

Fibroblast growth factor 4 (FGF4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mt:Cyt-b Antibody
orb804626 2 mg

Mt:Cyt-b Antibody

Sign In for Pricing
View Details
Mouse Ceramide synthase 3 (CERS3) ELISA Kit
abx506294 96 Tests

Mouse Ceramide synthase 3 (CERS3) ELISA Kit

Sign In for Pricing
View Details
Sodium Fluoride 98% Extrapure
02407 00500 500 g

Sodium Fluoride 98% Extrapure

Sign In for Pricing
View Details
Lentiviral mouse Pigq shRNA (UAS) - Lentiviral mouse Pigq shRNA (UAS, iRFP) plasmid
GTR15216220 1 Vial

Lentiviral mouse Pigq shRNA (UAS) - Lentiviral mouse Pigq shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rhoifolin
C13934-1mg 1 mg

Rhoifolin

Sign In for Pricing
View Details
p90 Autoantigen (KIAA1524) (NM_020890) Human Tagged ORF Clone Lentiviral Particle
RC219918L3V 200 µL

p90 Autoantigen (KIAA1524) (NM_020890) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details