Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6), Active Protein

Recombinant Human Interleukin-6 (IL6), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-6 (IL6) . Accession Number: P05231; IL-6. Expression Region: 30-212aa. Tag Info: Tag-Free. Theoretical MW: 20.8kda. Target Synonyms: Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-6 (IL6), Active Protein is a purified Active Recombinant Protein.

Accession Number

P05231; IL-6

Expression Region

30-212aa

Host

Mammalian Cells

Target

Interleukin-6 (IL6)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRO3 Antibody, FITC conjugated
A37801-50UG 50 µg

TYRO3 Antibody, FITC conjugated

Sign In for Pricing
View Details
KRT84 Rabbit Polyclonal Antibody
orb582743 100 µL

KRT84 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse CD1 Brain Region cDNA Panel, Set of any 5 Regions
MD-201-005 5x 10 Reactions

Mouse CD1 Brain Region cDNA Panel, Set of any 5 Regions

Sign In for Pricing
View Details
PSMD2 Antibody
orb1322970-01 30 µL

PSMD2 Antibody

Sign In for Pricing
View Details
PSMD2 Antibody
orb1322970-02 50 μL

PSMD2 Antibody

Sign In for Pricing
View Details
PSMD2 Antibody
orb1322970-03 100 µL

PSMD2 Antibody

Sign In for Pricing
View Details