Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor I (IGF1), Active Protein

Recombinant Human Insulin-like growth factor I (IGF1), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤10.0 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor I (IGF1) . Accession Number: P05019; LR3 IGF1. Expression Region: MFPAMPLSSLFVN+49-118aa (E51R) . Tag Info: Tag-Free. Theoretical MW: 9kda. Target Synonyms: Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor I (IGF1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P05019; LR3 IGF1

Expression Region

MFPAMPLSSLFVN+49-118aa (E51R)

Host

Mammalian Cells

Target

Insulin-like growth factor I (IGF1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤10.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KNTC1 CRISPRa sgRNA lentivector (set of three targets)(Human)
25898121 3x 1.0µg DNA

KNTC1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
2,2-Dioxo-2λ6-thia-1-azabicyclo[2.2.2]octane-4-carboxylic acid
MRD30030-01 50 mg

2,2-Dioxo-2λ6-thia-1-azabicyclo[2.2.2]octane-4-carboxylic acid

Sign In for Pricing
View Details
2,2-Dioxo-2λ6-thia-1-azabicyclo[2.2.2]octane-4-carboxylic acid
MRD30030-02 0.5 g

2,2-Dioxo-2λ6-thia-1-azabicyclo[2.2.2]octane-4-carboxylic acid

Sign In for Pricing
View Details
Rabbit Anti-Human PROX1 mAb
MA1360-01 50 μL

Rabbit Anti-Human PROX1 mAb

Sign In for Pricing
View Details
Rabbit Anti-Human PROX1 mAb
MA1360-02 100 μL

Rabbit Anti-Human PROX1 mAb

Sign In for Pricing
View Details
Dystrobrevin alpha (DTNA) (NM_032980) Human Over-expression Lysate
E45H13040-2 20 µg

Dystrobrevin alpha (DTNA) (NM_032980) Human Over-expression Lysate

Sign In for Pricing
View Details