Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: ≤200.0 EU/mg as determined by LAL method. Species: Bovine (Bos taurus) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P03969; bFGF/FGF-2. Expression Region: 10-155aa. Tag Info: Tag-Free. Theoretical MW: 16.5kda. Target Synonyms: Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P03969; bFGF/FGF-2

Expression Region

10-155aa

Host

E. coli

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤200.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

Species

Bovine (Bos taurus)

Protein Name

Active Recombinant Protein

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH2 Knockout AGS Polyclonal Cells
ARG27001 1 Million

IDH2 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral mouse Zfp799 shRNA (UAS) - Lentiviral mouse Zfp799 shRNA (UAS) (100)
GTR15223086 1 Vial

Lentiviral mouse Zfp799 shRNA (UAS) - Lentiviral mouse Zfp799 shRNA (UAS) (100)

Sign In for Pricing
View Details
LGALS12 Over-expression Lysate Product
GWB-B3AC06 0.1 mg

LGALS12 Over-expression Lysate Product

Sign In for Pricing
View Details
Human COMM Domain-Containing Protein 9 (COMMD9) ELISA Kit
abx507950 96 Tests

Human COMM Domain-Containing Protein 9 (COMMD9) ELISA Kit

Sign In for Pricing
View Details
ZNF366 Antibody
E51A12028 100 µL

ZNF366 Antibody

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody [Clone ID: 8B6]
AM06418SU-N 100 µL

CD69 Mouse Monoclonal Antibody [Clone ID: 8B6]

Sign In for Pricing
View Details