Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: ≤200.0 EU/mg as determined by LAL method. Species: Bovine (Bos taurus) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P03969; bFGF/FGF-2. Expression Region: 10-155aa. Tag Info: Tag-Free. Theoretical MW: 16.5kda. Target Synonyms: Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P03969; bFGF/FGF-2

Expression Region

10-155aa

Host

E. coli

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤200.0 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

Species

Bovine (Bos taurus)

Protein Name

Active Recombinant Protein

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLEC1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0606002 1.0 µg DNA

DLEC1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RBFOX2 Recombinant Protein (Mouse)
RP167057 100 µg

RBFOX2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Ccdc42 ORF Vector (Mouse) (pORF)
ORF040594 1.0 µg DNA

Ccdc42 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Research Grade Dulaglutide
DHE40129 100 μg

Research Grade Dulaglutide

Sign In for Pricing
View Details
KLHDC3 Rabbit pAb
E45R20311N-100 100 µL

KLHDC3 Rabbit pAb

Sign In for Pricing
View Details
PPT1 ORF Vector (Human) (pORF)
ORF008153 1.0 µg DNA

PPT1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details