Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial , Active Protein

Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: ≤0.5 EU/mg as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Alpha-2-HS-glycoprotein (AHSG) . Accession Number: P02765; Fetuin A. Expression Region: 19-300aa&341-367aa. Tag Info: Tag-Free. Theoretical MW: 32.9kda. Target Synonyms: Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Alpha-2-HS-glycoprotein (AHSG), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P02765; Fetuin A

Expression Region

19-300aa&341-367aa

Host

Mammalian Cells

Target

Alpha-2-HS-glycoprotein (AHSG)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Others

Endotoxin

≤0.5 EU/mg, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

TVVQPSVGAAAGPVVPPCPGRIRHFKV&APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2P4 Protein Vector (Human) (pPM-C-His)
PV115345 500 ng

RCC2P4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (MaxLight 490)
130471-ML490 100 µL

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral mouse Atp5h shRNA (UAS) - Lentiviral mouse Atp5h shRNA (UAS, RFP) (100)
GTR15229512 1 Vial

Lentiviral mouse Atp5h shRNA (UAS) - Lentiviral mouse Atp5h shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Protein shisa-5 (SHISA5) Rat ELISA Kit
G4156 96 Tests

Protein shisa-5 (SHISA5) Rat ELISA Kit

Sign In for Pricing
View Details
NUDT22 Protein Vector (Human) (pPM-C-HA)
PV029151 500 ng

NUDT22 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Stem Cell Factor (SCF) ELISA Kit
MBS4502373-01 48 Tests

Rat Stem Cell Factor (SCF) ELISA Kit

Sign In for Pricing
View Details