Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: MHC class I polypeptide-related sequence A (MICA) . Accession Number: AAH16929.1; MICA. Expression Region: 24-308aa. Tag Info: C-terminal Fc-tagged. Theoretical MW: 59.9kda. Target Synonyms: MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

AAH16929.1; MICA

Expression Region

24-308aa

Host

Mammalian Cells

Target

MHC class I polypeptide-related sequence A (MICA)

Conjugation

Unconjugated

Tag

C-Terminal Fc-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD102-FITC
31-2273-0.1 0.1 mg

Rat Anti-Mouse CD102-FITC

Sign In for Pricing
View Details
Human PARK2 knockdown cell line
ABC-KD11120 1 Vial

Human PARK2 knockdown cell line

Sign In for Pricing
View Details
CD49e (VLA-5, Integrin alpha 5 Chain) (HRP)
MBS6250635-01 0.1 mL

CD49e (VLA-5, Integrin alpha 5 Chain) (HRP)

Sign In for Pricing
View Details
CD49e (VLA-5, Integrin alpha 5 Chain) (HRP)
MBS6250635-02 5x 0.1 mL

CD49e (VLA-5, Integrin alpha 5 Chain) (HRP)

Sign In for Pricing
View Details
Gpr151 (NM_181633) Rat Tagged ORF Clone Lentiviral Particle
RR208766L3V 200 µL

Gpr151 (NM_181633) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
COMMD10, ID (COMMD10, COMM domain-containing protein 10) (AP)
MBS6287790-01 0.2 mL

COMMD10, ID (COMMD10, COMM domain-containing protein 10) (AP)

Sign In for Pricing
View Details