Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: MHC class I polypeptide-related sequence A (MICA) . Accession Number: AAH16929.1; MICA. Expression Region: 24-308aa. Tag Info: C-terminal Fc-tagged. Theoretical MW: 59.9kda. Target Synonyms: MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

AAH16929.1; MICA

Expression Region

24-308aa

Host

Mammalian Cells

Target

MHC class I polypeptide-related sequence A (MICA)

Conjugation

Unconjugated

Tag

C-Terminal Fc-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP133 (NM_018230) Human Mass Spec Standard
PH304410 10 µg

NUP133 (NM_018230) Human Mass Spec Standard

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF405S conjugate, 0.1mg/mL
BNC042840-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLHL15 Rabbit pAb
E45R23174N-100 100 µL

KLHL15 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) pgl Polyclonal Antibody
MBS7141121 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) pgl Polyclonal Antibody

Sign In for Pricing
View Details
Nori® Human Prolactin ELISA Kit
GR106401 96 Well

Nori® Human Prolactin ELISA Kit

Sign In for Pricing
View Details
USP25 Human qPCR Template Standard (NM_013396)
HK207830 1 Kit

USP25 Human qPCR Template Standard (NM_013396)

Sign In for Pricing
View Details