Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A4 (EFNA4), partial , Active Protein

Recombinant Human Ephrin-A4 (EFNA4), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Ephrin-A4 (EFNA4) . Accession Number: P52798; EFNA4. Expression Region: 26-171aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44.3kda. Target Synonyms: Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ephrin-A4 (EFNA4), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P52798; EFNA4

Expression Region

26-171aa

Host

Mammalian Cells

Target

Ephrin-A4 (EFNA4)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cardiovascular

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO Protease, GST-tag (SUMO-P (GST) )
A32L-10KU 10 KU

SUMO Protease, GST-tag (SUMO-P (GST) )

Sign In for Pricing
View Details
VN1R40P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV789436 1.0 µg DNA

VN1R40P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)
MBS2569178-01 0.01 mg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)
MBS2569178-02 0.05 mg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)
MBS2569178-03 5x 0.05 mg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-3/HER3 (C-Fc)

Sign In for Pricing
View Details
Human CERK (Ceramide kinase) QuickTest ELISA Kit
QT-EH1538 96 Tests

Human CERK (Ceramide kinase) QuickTest ELISA Kit

Sign In for Pricing
View Details