Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic anhydrase-related protein (CA8), partial , Active Protein

Recombinant Human Carbonic anhydrase-related protein (CA8), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Carbonic anhydrase-related protein (CA8) . Accession Number: P35219; CA8. Expression Region: 2-290aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 34.04kda. Target Synonyms: Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Carbonic anhydrase-related protein (CA8), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P35219; CA8

Expression Region

2-290aa

Host

E. coli

Target

Carbonic anhydrase-related protein (CA8)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.04kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN6 Protein (N-GST, Human)
P527927 100 µg

PTPN6 Protein (N-GST, Human)

Sign In for Pricing
View Details
Trim35-set siRNA/shRNA/RNAi Lentivector (Rat)
47775096 4x 500 ng

Trim35-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli hlyD Polyclonal Antibody
MBS7164604 Inquire

Rabbit anti-Escherichia coli hlyD Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 2 (CASP2) Human shRNA Plasmid Kit (Locus ID 835)
TL316476 1 Kit

Caspase 2 (CASP2) Human shRNA Plasmid Kit (Locus ID 835)

Sign In for Pricing
View Details
PL6 (TMEM115) (NM_007024) Human Over-expression Lysate
LH08487V 100 µg

PL6 (TMEM115) (NM_007024) Human Over-expression Lysate

Sign In for Pricing
View Details
Vidofludimus calcium
330059 10.0mg

Vidofludimus calcium

Sign In for Pricing
View Details