Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) . Accession Number: Q07011; TNFRSF9. Expression Region: 24-186aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44kda. Target Synonyms: CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9

Expression Region

24-186aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1379) - Azide and BSA Free
NBP2-54442-100ug 100 µg

Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1379) - Azide and BSA Free

Sign In for Pricing
View Details
HS3ST5 (NM_153612) Human Recombinant Protein
PH31843E1 50 µg

HS3ST5 (NM_153612) Human Recombinant Protein

Sign In for Pricing
View Details
PIGG (NM_017733) Human Tagged ORF Clone
RG214539 10 µg

PIGG (NM_017733) Human Tagged ORF Clone

Sign In for Pricing
View Details
ADH4 Human shRNA Lentiviral Particle (Locus ID 127)
TL314928V 500 µL Each

ADH4 Human shRNA Lentiviral Particle (Locus ID 127)

Sign In for Pricing
View Details
CSTF3 Polyclonal Antibody
MBS9131660-01 0.02 mL

CSTF3 Polyclonal Antibody

Sign In for Pricing
View Details
CSTF3 Polyclonal Antibody
MBS9131660-02 0.1 mL

CSTF3 Polyclonal Antibody

Sign In for Pricing
View Details