Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) . Accession Number: Q07011; TNFRSF9. Expression Region: 24-186aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44kda. Target Synonyms: CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9

Expression Region

24-186aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cartap hydrochloride
558121 100.0mg

Cartap hydrochloride

Sign In for Pricing
View Details
Mouse Dync1i2 (NM_001198875) AAV Particle
MR230696A1V 250 µL

Mouse Dync1i2 (NM_001198875) AAV Particle

Sign In for Pricing
View Details
SH3BGRL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2139906 1.0 µg DNA

SH3BGRL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human ZC3H12D qPCR Primer Pair
QH72981S 200 Tests

Human ZC3H12D qPCR Primer Pair

Sign In for Pricing
View Details
pUNO1-hBTLAa
puno1-hbtla 20 µg

pUNO1-hBTLAa

Sign In for Pricing
View Details
Human HLA B-81 alpha ELISA KIT
ELI-24621h 96 Tests

Human HLA B-81 alpha ELISA KIT

Sign In for Pricing
View Details