Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) . Accession Number: Q07011; TNFRSF9. Expression Region: 24-186aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44kda. Target Synonyms: CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9

Expression Region

24-186aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ERGIC2 shRNA (UAS) - Lentiviral human ERGIC2 shRNA (UAS) plasmid
GTR15331714 1 Vial

Lentiviral human ERGIC2 shRNA (UAS) - Lentiviral human ERGIC2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Hsa-miR-8056 agomir
HY-R02448A-01 5 nmol

Hsa-miR-8056 agomir

Sign In for Pricing
View Details
Hsa-miR-8056 agomir
HY-R02448A-02 20 nmol

Hsa-miR-8056 agomir

Sign In for Pricing
View Details
Dog/Canine Asporin ASPN ELISA Kit
BG-CAN10061 1 Each

Dog/Canine Asporin ASPN ELISA Kit

Sign In for Pricing
View Details
Rat Mgarp Pre-designed siRNA Set A
SI208394A 1 Each

Rat Mgarp Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ciao1 (NM_025296) Mouse Untagged Clone
MC200380 10 µg

Ciao1 (NM_025296) Mouse Untagged Clone

Sign In for Pricing
View Details