Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) . Accession Number: Q07011; TNFRSF9. Expression Region: 24-186aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44kda. Target Synonyms: CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9

Expression Region

24-186aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biolit FluroBronze Stain
50358-1 250 mcl

Biolit FluroBronze Stain

Sign In for Pricing
View Details
Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)
FY-AB41893-01 1 mL

Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)

Sign In for Pricing
View Details
Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)
FY-AB41893-02 100 µL

Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)

Sign In for Pricing
View Details
Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)
FY-AB41893-03 200 µL

Biotin-Linked Anti-Heat Shock Protein 27 (HSP27)

Sign In for Pricing
View Details
Killer Cell Lectin Like Receptor C1 (KLRC1) Antibody
abx331014 100 µL

Killer Cell Lectin Like Receptor C1 (KLRC1) Antibody

Sign In for Pricing
View Details
Recombinant E.coli Phosphoenolpyruvate carboxylase Protein, His, E.coli-50ug
QP8934-ec-50ug 50ug

Recombinant E.coli Phosphoenolpyruvate carboxylase Protein, His, E.coli-50ug

Sign In for Pricing
View Details