Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) . Accession Number: Q07011; TNFRSF9. Expression Region: 24-186aa. Tag Info: C-terminal 6xHis-Fc-tagged. Theoretical MW: 44kda. Target Synonyms: CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9

Expression Region

24-186aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SIRT6 Antibody [DyLight 405]
NB100-2524V 0.1 mL

Rabbit Polyclonal SIRT6 Antibody [DyLight 405]

Sign In for Pricing
View Details
RAD17 Antibody
ABD7299 100 µg

RAD17 Antibody

Sign In for Pricing
View Details
ZNHIT2 antibody
70R-21423 50 ul

ZNHIT2 antibody

Sign In for Pricing
View Details
Human Keratin-associated protein 5-10 (KRTAP5-10) ELISA Kit
abx530412 96 Tests

Human Keratin-associated protein 5-10 (KRTAP5-10) ELISA Kit

Sign In for Pricing
View Details
Heat shock 70 kDa protein BIP1 (BIP1) Antibody (FITC)
abx349480-01 50 µL

Heat shock 70 kDa protein BIP1 (BIP1) Antibody (FITC)

Sign In for Pricing
View Details
Heat shock 70 kDa protein BIP1 (BIP1) Antibody (FITC)
abx349480-02 100 µL

Heat shock 70 kDa protein BIP1 (BIP1) Antibody (FITC)

Sign In for Pricing
View Details