Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial , Active Protein

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) . Accession Number: AAH17865.1; FCGR3A. Expression Region: 17-208aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22.61kda. Target Synonyms: Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

AAH17865.1; FCGR3A

Expression Region

17-208aa

Host

Mammalian Cells

Target

Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.61kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folic acid
CMS175-5G 1 unit

Folic acid

Sign In for Pricing
View Details
BALB/c Mouse Liver Epithelial Cells
ABC-TC3082 1 Vial

BALB/c Mouse Liver Epithelial Cells

Sign In for Pricing
View Details
Anti-Mouse PD-1 (RMP1-14) - Ultra Low Endotoxin 5mg/ml
ICH1132ULEC5-50mg 50 mg

Anti-Mouse PD-1 (RMP1-14) - Ultra Low Endotoxin 5mg/ml

Sign In for Pricing
View Details
PLA2G2D Recombinant Protein (Human)
RP023674 100 µg

PLA2G2D Recombinant Protein (Human)

Sign In for Pricing
View Details
STYX sgRNA CRISPR Lentivector (Human) (Target 3)
K2310504 1.0 µg DNA

STYX sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (007) [Alexa Fluor 594]
NBP2-89895AF594 0.1 mL

Rabbit Monoclonal Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (007) [Alexa Fluor 594]

Sign In for Pricing
View Details