Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Tumor necrosis factor (Tnf) . Accession Number: P06804; Tnf. Expression Region: 89-235aa. Tag Info: Tag-Free. Theoretical MW: 16.4kda. Target Synonyms: Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P06804; Tnf

Expression Region

89-235aa

Host

E. coli

Target

Tumor necrosis factor (Tnf)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Bovis folE Protein (aa 1-202)
VAng-Yyj3298-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis folE Protein (aa 1-202)

Sign In for Pricing
View Details
Fluo-3, pentapotassium salt
MBS5759636 Inquire

Fluo-3, pentapotassium salt

Sign In for Pricing
View Details
Anti-CCR4 Antibody Picoband® (PE Conjugate)
A00755-PE 100 µg/Vial

Anti-CCR4 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
PKC delta Antibody
R30160 100 µg

PKC delta Antibody

Sign In for Pricing
View Details
LASP1 AAV siRNA Pooled Vector
26318161 1.0 µg

LASP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Rat TNF-alpha Protein (His-tag)
GB300031-R-100μg 100 μg

Recombinant Rat TNF-alpha Protein (His-tag)

Sign In for Pricing
View Details