Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Tumor necrosis factor (Tnf) . Accession Number: P06804; Tnf. Expression Region: 89-235aa. Tag Info: Tag-Free. Theoretical MW: 16.4kda. Target Synonyms: Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Tumor necrosis factor (Tnf), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P06804; Tnf

Expression Region

89-235aa

Host

E. coli

Target

Tumor necrosis factor (Tnf)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pas4 Polyclonal Antibody
MBS9013686 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pas4 Polyclonal Antibody

Sign In for Pricing
View Details
THBD (Thrombomodulin, TM, THRM, AHUS6, BDCA3, CD141, THPH12) (HRP)
MBS6440558-01 0.1 mL

THBD (Thrombomodulin, TM, THRM, AHUS6, BDCA3, CD141, THPH12) (HRP)

Sign In for Pricing
View Details
THBD (Thrombomodulin, TM, THRM, AHUS6, BDCA3, CD141, THPH12) (HRP)
MBS6440558-02 5x 0.1 mL

THBD (Thrombomodulin, TM, THRM, AHUS6, BDCA3, CD141, THPH12) (HRP)

Sign In for Pricing
View Details
Human OPN (Osteopontin) ELISA Kit
EK240560 96 Well

Human OPN (Osteopontin) ELISA Kit

Sign In for Pricing
View Details
Donkey Cyclophilin A ELISA Kit
MBS059257 Inquire

Donkey Cyclophilin A ELISA Kit

Sign In for Pricing
View Details
Canine Cysteine protease ATG4D (ATG4D) ELISA Kit
MBS7250554-01 48 Well

Canine Cysteine protease ATG4D (ATG4D) ELISA Kit

Sign In for Pricing
View Details