Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) . Accession Number: O00300; TNFRSF11B. Expression Region: 22-401aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 44.65kda. Target Synonyms: Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B), Active Protein is a purified Active Recombinant Protein.

Accession Number

O00300; TNFRSF11B

Expression Region

22-401aa

Host

Mammalian Cells

Target

Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.65kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Varicella Zoster Virus, IE62 (VZV) (MaxLight 490) discontinued
V2100-13D-ML490 100 µL

Varicella Zoster Virus, IE62 (VZV) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Human TREML2, His tagged
TREML2-3227H 50 µg

Recombinant Human TREML2, His tagged

Sign In for Pricing
View Details
Mouse Monoclonal PAGE1 Antibody (OTI3E7) [HRP]
NBP2-73230H 0.1 mL

Mouse Monoclonal PAGE1 Antibody (OTI3E7) [HRP]

Sign In for Pricing
View Details
Lzts3 Mouse siRNA Oligo Duplex (Locus ID 241638)
SR417296 1 Kit

Lzts3 Mouse siRNA Oligo Duplex (Locus ID 241638)

Sign In for Pricing
View Details
NPY2R 3'UTR GFP Stable Cell Line
TU065925 1.0 mL

NPY2R 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bad, Phosphorylated (S112) (Bcl2 Antagonist of Cell Death, BBC2, BCL2L8) (HRP)
MBS6408075-01 0.1 mL

Bad, Phosphorylated (S112) (Bcl2 Antagonist of Cell Death, BBC2, BCL2L8) (HRP)

Sign In for Pricing
View Details