Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial , Active Protein

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial , Active Protein is a purified Active Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor ligand superfamily member 11 (TNFSF11) . Accession Number: O14788; TNFSF11. Expression Region: 140-317aa. Tag Info: Tag-Free. Theoretical MW: 22.4kda. Target Synonyms: CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

O14788; TNFSF11

Expression Region

140-317aa

Host

E. coli

Target

Tumor necrosis factor ligand superfamily member 11 (TNFSF11)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>90% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13C4 CRISPR/Cas9 KO Plasmid (h)
sc-414455 20 µg

OR13C4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
(Met (O) 35) -Amyloid β-Protein (1-42)
HY-P3781 1 Each

(Met (O) 35) -Amyloid β-Protein (1-42)

Sign In for Pricing
View Details
3110057O12Rik 3'UTR GFP Stable Cell Line
TU150588 1.0 mL

3110057O12Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FMNL1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0789204 1.0 µg DNA

FMNL1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
LOC690134 3'UTR Luciferase Stable Cell Line
TU212058 1.0 mL

LOC690134 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TPO ORF Vector (Human) (pORF)
ORF010895 1.0 µg DNA

TPO ORF Vector (Human) (pORF)

Sign In for Pricing
View Details