Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-17A (Il17a) . Accession Number: Q62386; Il17a. Expression Region: 22-158aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 16.2kda. Target Synonyms: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q62386; Il17a

Expression Region

22-158aa

Host

Mammalian Cells

Target

Interleukin-17A (Il17a)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LOX-1/OLR1 Antibody (331212) [DyLight 350]
FAB1798D 0.1 mL

Mouse Monoclonal LOX-1/OLR1 Antibody (331212) [DyLight 350]

Sign In for Pricing
View Details
Phospho-RPS6KA1 (Ser352) Rabbit Polyclonal Antibody (PE-Cy7)
orb894479 100 µL

Phospho-RPS6KA1 (Ser352) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Tefibazumab Human Monoclonal Antibody
orb2978065-01 100 µg

Tefibazumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Tefibazumab Human Monoclonal Antibody
orb2978065-02 1 mg

Tefibazumab Human Monoclonal Antibody

Sign In for Pricing
View Details
LOC678741 3'UTR Luciferase Stable Cell Line
TU210371 1.0 mL

LOC678741 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AAGAB Knockout Raji Polyclonal Cells
ARG20974 1 Million

AAGAB Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details