Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-17A (Il17a) . Accession Number: Q62386; Il17a. Expression Region: 22-158aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 16.2kda. Target Synonyms: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-17A (Il17a), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q62386; Il17a

Expression Region

22-158aa

Host

Mammalian Cells

Target

Interleukin-17A (Il17a)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDNF (Glial Cell Line-derived Neurotrophic Factor, hGDNF, Astrocyte-derived Trophic Factor, ATF) (APC)
127260-APC 100 µL

GDNF (Glial Cell Line-derived Neurotrophic Factor, hGDNF, Astrocyte-derived Trophic Factor, ATF) (APC)

Sign In for Pricing
View Details
Nxph1 3'UTR Lenti-reporter-Luc Vector
32367086 1.0 µg

Nxph1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1) Human ELISA Kit
D7799 96 Tests

Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 (GPIHBP1) Human ELISA Kit

Sign In for Pricing
View Details
YidD Antibody
orb831223 2 mg

YidD Antibody

Sign In for Pricing
View Details
Lentiviral human KIFBP shRNA (UAS) - Lentiviral human KIFBP shRNA (UAS, iRFP) (25)
GTR15097874 1 Vial

Lentiviral human KIFBP shRNA (UAS) - Lentiviral human KIFBP shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZMIZ1 Antibody
CSB-PA103365-01 50 μL

ZMIZ1 Antibody

Sign In for Pricing
View Details