Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-13 (Il13) . Accession Number: P20109; Il13. Expression Region: 22-131aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 13.1kda. Target Synonyms: Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P20109; Il13

Expression Region

22-131aa

Host

Mammalian Cells

Target

Interleukin-13 (Il13)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clk3, NT (Clk3, Dual specificity protein kinase CLK3, CDC-like kinase 3) (Azide free) (HRP)
MBS6286826-01 0.2 mL

Clk3, NT (Clk3, Dual specificity protein kinase CLK3, CDC-like kinase 3) (Azide free) (HRP)

Sign In for Pricing
View Details
Clk3, NT (Clk3, Dual specificity protein kinase CLK3, CDC-like kinase 3) (Azide free) (HRP)
MBS6286826-02 5x 0.2 mL

Clk3, NT (Clk3, Dual specificity protein kinase CLK3, CDC-like kinase 3) (Azide free) (HRP)

Sign In for Pricing
View Details
Wilms Tumor Protein (WT1) CytoSection
TS420079P5 25 Slides

Wilms Tumor Protein (WT1) CytoSection

Sign In for Pricing
View Details
SMAD2, phosphorylated (Ser118) (Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, Mad-related Protein 2, hMAD-2, SMAD Family Member 2, SMAD 2, hSMAD2, JV18-1, MADR2, MADH2)
S1014-52M 200 µL

SMAD2, phosphorylated (Ser118) (Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, Mad-related Protein 2, hMAD-2, SMAD Family Member 2, SMAD 2, hSMAD2, JV18-1, MADR2, MADH2)

Sign In for Pricing
View Details
HPLC Column, SiO2,5μm,120Å,4.0x50mm
13011934 1 PC

HPLC Column, SiO2,5μm,120Å,4.0x50mm

Sign In for Pricing
View Details
Sheep Anti-Rat IgG(H+L)-BIOT
MBS679434-01 1 mg

Sheep Anti-Rat IgG(H+L)-BIOT

Sign In for Pricing
View Details