Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-13 (Il13) . Accession Number: P20109; Il13. Expression Region: 22-131aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 13.1kda. Target Synonyms: Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P20109; Il13

Expression Region

22-131aa

Host

Mammalian Cells

Target

Interleukin-13 (Il13)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EML2 CRISPR Activation Plasmid (m2)
sc-428279-ACT-2 20 µg

EML2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
ELMO1 Antibody - C-terminal region : HRP (ARP59647_P050-HRP)
ARP59647_P050-HRP 100 µL

ELMO1 Antibody - C-terminal region : HRP (ARP59647_P050-HRP)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
orb1808024-01 48 Tests

Mouse Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
orb1808024-02 96 Tests

Mouse Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
PIC P035-Dia 025-PE-SHEET/7 AC Signs
831334 Vel of 7 Pictogram(s)

PIC P035-Dia 025-PE-SHEET/7 AC Signs

Sign In for Pricing
View Details
50 Well Freezer Rack with Hinged Lid, Flour. Orange w/lid, 1 ea
TR-50-FOL 1 Each

50 Well Freezer Rack with Hinged Lid, Flour. Orange w/lid, 1 ea

Sign In for Pricing
View Details