Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-13 (Il13) . Accession Number: P20109; Il13. Expression Region: 22-131aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 13.1kda. Target Synonyms: Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-13 (Il13), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P20109; Il13

Expression Region

22-131aa

Host

Mammalian Cells

Target

Interleukin-13 (Il13)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 750)
MBS6234957-01 0.1 mL

RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 750)

Sign In for Pricing
View Details
RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 750)
MBS6234957-02 5x 0.1 mL

RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human GSTO1 Protein, N-His
orb3058938-01 50 µg

Recombinant Human GSTO1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSTO1 Protein, N-His
orb3058938-02 100 µg

Recombinant Human GSTO1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GSTO1 Protein, N-His
orb3058938-03 1 mg

Recombinant Human GSTO1 Protein, N-His

Sign In for Pricing
View Details
BGT226 (NVP-BGT226) maleate
C08826-5mg 5 mg

BGT226 (NVP-BGT226) maleate

Sign In for Pricing
View Details