Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17F (IL17F), Active Protein

Recombinant Human Interleukin-17F (IL17F), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-17F (IL17F) . Accession Number: AAH70124.1; IL17F. Expression Region: 31-163aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 15.96kda. Target Synonyms: Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-17F (IL17F), Active Protein is a purified Active Recombinant Protein.

Accession Number

AAH70124.1; IL17F

Expression Region

31-163aa

Host

Mammalian Cells

Target

Interleukin-17F (IL17F)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.96kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MENT Antibody, FITC conjugated
MBS7104311-01 0.05 mg

MENT Antibody, FITC conjugated

Sign In for Pricing
View Details
MENT Antibody, FITC conjugated
MBS7104311-02 0.1 mg

MENT Antibody, FITC conjugated

Sign In for Pricing
View Details
MENT Antibody, FITC conjugated
MBS7104311-03 5x 0.1 mg

MENT Antibody, FITC conjugated

Sign In for Pricing
View Details
Histone cluster 1 H3A siRNA (m)
sc-146003 10 µM

Histone cluster 1 H3A siRNA (m)

Sign In for Pricing
View Details
6-[(2-tert-Butoxycarbonylaminoethyl)amino]-7-chloro-1-cyclopropyl-1,4-dihydro-4-oxo-quinoline-3-carboxylic Acid
MBS6014807-01 5 mg

6-[(2-tert-Butoxycarbonylaminoethyl)amino]-7-chloro-1-cyclopropyl-1,4-dihydro-4-oxo-quinoline-3-carboxylic Acid

Sign In for Pricing
View Details
6-[(2-tert-Butoxycarbonylaminoethyl)amino]-7-chloro-1-cyclopropyl-1,4-dihydro-4-oxo-quinoline-3-carboxylic Acid
MBS6014807-02 5x 5 mg

6-[(2-tert-Butoxycarbonylaminoethyl)amino]-7-chloro-1-cyclopropyl-1,4-dihydro-4-oxo-quinoline-3-carboxylic Acid

Sign In for Pricing
View Details