Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-7 (IL7), Active Protein

Recombinant Human Interleukin-7 (IL7), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-7 (IL7) . Accession Number: P13232; IL7. Expression Region: 26-177aa. Tag Info: Tag-Free. Theoretical MW: 17.5kda. Target Synonyms: Interleukin-7; IL-7; IL7 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-7 (IL7), Active Protein is a purified Active Recombinant Protein.

Accession Number

P13232; IL7

Expression Region

26-177aa

Host

E. coli

Target

Interleukin-7 (IL7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-7; IL-7; IL7

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XBP1 Antibody, mAb, Rabbit
A03536-50 50 µL

XBP1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Purified Anti-Mouse IL-4 Antibody
MBS4515116-01 0.025 mg

Purified Anti-Mouse IL-4 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse IL-4 Antibody
MBS4515116-02 0.1 mg

Purified Anti-Mouse IL-4 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse IL-4 Antibody
MBS4515116-03 5x 0.1 mg

Purified Anti-Mouse IL-4 Antibody

Sign In for Pricing
View Details
MRPS18B Rabbit Polyclonal Antibody (Fluoro594)
orb3094323 100 µg

MRPS18B Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
HLA-C, ID (HLA-C, HLAC, HLA class I histocompatibility antigen, Cw-7 alpha chain, MHC class I antigen Cw*7) (FITC) discontinued
036617-FITC 200 µL

HLA-C, ID (HLA-C, HLAC, HLA class I histocompatibility antigen, Cw-7 alpha chain, MHC class I antigen Cw*7) (FITC) discontinued

Sign In for Pricing
View Details