Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial , Active Protein

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-4 receptor subunit alpha (IL4R) . Accession Number: P24394; IL4R. Expression Region: 26-231aa. Tag Info: C-terminal Fc-tagged. Theoretical MW: 50.2kda. Target Synonyms: Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P24394; IL4R

Expression Region

26-231aa

Host

Mammalian Cells

Target

Interleukin-4 receptor subunit alpha (IL4R)

Conjugation

Unconjugated

Tag

C-Terminal Fc-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit
MBS287050-01 48 Tests

Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit

Sign In for Pricing
View Details
Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit
MBS287050-02 96 Tests

Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit

Sign In for Pricing
View Details
Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit
MBS287050-03 5x 96 Tests

Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit

Sign In for Pricing
View Details
Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit
MBS287050-04 10x 96 Tests

Human Heat shock protein 90-alpha (HSP-90alpha) ELISA Kit

Sign In for Pricing
View Details
H2 (BC058170) Mouse Untagged Clone
MC218175 10 µg

H2 (BC058170) Mouse Untagged Clone

Sign In for Pricing
View Details
PLAAT3 Antibody
KC-8194-01 50 μL

PLAAT3 Antibody

Sign In for Pricing
View Details