Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG), Active Protein

Recombinant Human Interferon gamma (IFNG), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interferon gamma (IFNG) . Accession Number: P01579; IFNG. Expression Region: 24-166aa. Tag Info: Tag-Free. Theoretical MW: 16.88kda. Target Synonyms: Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon gamma (IFNG), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01579; IFNG

Expression Region

24-166aa

Host

E. coli

Target

Interferon gamma (IFNG)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.88kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PGM1 (NM_001172818) Human Over-expression Lysate
LY433308 100 µg

PGM1 (NM_001172818) Human Over-expression Lysate

Ask
View Details
ADSS, CT (ADSS, ADSS2, Adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, IMP-aspartate ligase 2) (Biotin)
MBS6271961-01 0.2 mL

ADSS, CT (ADSS, ADSS2, Adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, IMP-aspartate ligase 2) (Biotin)

Ask
View Details
ADSS, CT (ADSS, ADSS2, Adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, IMP-aspartate ligase 2) (Biotin)
MBS6271961-02 5x 0.2 mL

ADSS, CT (ADSS, ADSS2, Adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, IMP-aspartate ligase 2) (Biotin)

Ask
View Details
EEF1A1, CT (Elongation Factor 1-alpha 1, EF-1-alpha-1, Eukaryotic Elongation Factor 1 A-1, Elongation Factor 1 A-1, eEF1A-1, Elongation Factor Tu, EF-Tu, Leukocyte Receptor Cluster Member 7, LENG7, EF1A, EEF1A) (MaxLight 490)
MBS6473569-01 0.1 mL

EEF1A1, CT (Elongation Factor 1-alpha 1, EF-1-alpha-1, Eukaryotic Elongation Factor 1 A-1, Elongation Factor 1 A-1, eEF1A-1, Elongation Factor Tu, EF-Tu, Leukocyte Receptor Cluster Member 7, LENG7, EF1A, EEF1A) (MaxLight 490)

Ask
View Details
EEF1A1, CT (Elongation Factor 1-alpha 1, EF-1-alpha-1, Eukaryotic Elongation Factor 1 A-1, Elongation Factor 1 A-1, eEF1A-1, Elongation Factor Tu, EF-Tu, Leukocyte Receptor Cluster Member 7, LENG7, EF1A, EEF1A) (MaxLight 490)
MBS6473569-02 5x 0.1 mL

EEF1A1, CT (Elongation Factor 1-alpha 1, EF-1-alpha-1, Eukaryotic Elongation Factor 1 A-1, Elongation Factor 1 A-1, eEF1A-1, Elongation Factor Tu, EF-Tu, Leukocyte Receptor Cluster Member 7, LENG7, EF1A, EEF1A) (MaxLight 490)

Ask
View Details
Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) ATPB Polyclonal Antibody
MBS7192686 Inquire

Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) ATPB Polyclonal Antibody

Ask
View Details