Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb), Active Protein

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Platelet-derived growth factor subunit B (Pdgfb) . Accession Number: AAH53430.1; Pdgfb. Expression Region: 82-190aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 13.4kda. Target Synonyms: Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb), Active Protein is a purified Active Recombinant Protein.

Accession Number

AAH53430.1; Pdgfb

Expression Region

82-190aa

Host

E. coli

Target

Platelet-derived growth factor subunit B (Pdgfb)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTBP1 (C-terminal Binding Protein 1, BARS, MGC104684) (MaxLight 490)
245040-ML490 100 µL

CTBP1 (C-terminal Binding Protein 1, BARS, MGC104684) (MaxLight 490)

Sign In for Pricing
View Details
TSPY1 Recombinant Protein (Rat)
RP235043 100 µg

TSPY1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
hsa-miR-6084 miRNA Agomir
MBS8312654-01 5 nmol

hsa-miR-6084 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6084 miRNA Agomir
MBS8312654-02 10 nmol

hsa-miR-6084 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6084 miRNA Agomir
MBS8312654-03 20 nmol

hsa-miR-6084 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6084 miRNA Agomir
MBS8312654-04 5x 20 nmol

hsa-miR-6084 miRNA Agomir

Sign In for Pricing
View Details