Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pro-epidermal growth factor (Egf), partial , Active Protein

Recombinant Mouse Pro-epidermal growth factor (Egf), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Pro-epidermal growth factor (Egf) . Accession Number: P01132; Egf. Expression Region: 977-1029aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 7.2kda. Target Synonyms: Pro-epidermal growth factor; Epidermal growth factor; EGF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Pro-epidermal growth factor (Egf), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P01132; Egf

Expression Region

977-1029aa

Host

E. coli

Target

Pro-epidermal growth factor (Egf)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pro-epidermal growth factor; Epidermal growth factor; EGF

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Pseudomonas putida (Arthrobacter siderocapsulatus) DNAA Polyclonal Antibody
MBS7162525 Inquire

Rabbit anti-Pseudomonas putida (Arthrobacter siderocapsulatus) DNAA Polyclonal Antibody

Sign In for Pricing
View Details
Slc23a3 Mouse shRNA Plasmid (Locus ID 22626)
TR502440 1 Kit

Slc23a3 Mouse shRNA Plasmid (Locus ID 22626)

Sign In for Pricing
View Details
Chicken Olfactory receptor 10G3 (OR10G3) ELISA Kit
GTR10328178 96 Well

Chicken Olfactory receptor 10G3 (OR10G3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal DNAJC12 Antibody [DyLight 550]
NBP2-97428R 0.1 mL

Rabbit Polyclonal DNAJC12 Antibody [DyLight 550]

Sign In for Pricing
View Details
Anti-Purple sea urchin P63 Antibody-iFluor647 Conjugate
DZ41453-iFluor647 200 µL

Anti-Purple sea urchin P63 Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
2310044H10Rik AAV Vector (Mouse) (CMV)
10402104 1 µg

2310044H10Rik AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details