Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-nerve growth factor (NGF), partial , Active Protein

Recombinant Human Beta-nerve growth factor (NGF), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Beta-nerve growth factor (NGF) . Accession Number: P01138; NGF. Expression Region: 122-239aa. Tag Info: Tag-Free. Theoretical MW: 13.5kda. Target Synonyms: Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Beta-nerve growth factor (NGF), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P01138; NGF

Expression Region

122-239aa

Host

Mammalian Cells

Target

Beta-nerve growth factor (NGF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey anti-Sheep IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG
MBS687736-01 2 mg

Donkey anti-Sheep IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG

Sign In for Pricing
View Details
Donkey anti-Sheep IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG
MBS687736-02 5x 2 mg

Donkey anti-Sheep IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG

Sign In for Pricing
View Details
Quick Step Bovine Omentin ELISA Kit
QS0262Bo-01 48 Tests

Quick Step Bovine Omentin ELISA Kit

Sign In for Pricing
View Details
Quick Step Bovine Omentin ELISA Kit
QS0262Bo-02 96 Tests

Quick Step Bovine Omentin ELISA Kit

Sign In for Pricing
View Details
ZNF575 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-13588R-BF555 100 µL

ZNF575 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
F13A1 Antibody
orb751100-01 20 µg

F13A1 Antibody

Sign In for Pricing
View Details