Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 17 (FGF17) . Accession Number: O60258; FGF17. Expression Region: 23-216aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22.64kda. Target Synonyms: Fibroblast Growth Factor 17; FGF-17; FGF17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 17 (FGF17), Active Protein is a purified Active Recombinant Protein.

Accession Number

O60258; FGF17

Expression Region

23-216aa

Host

Mammalian Cells

Target

Fibroblast growth factor 17 (FGF17)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 17; FGF-17; FGF17

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RARα (C-1) Alexa Fluor® 647
sc-515796 AF647 200 µg/mL

RARα (C-1) Alexa Fluor® 647

Sign In for Pricing
View Details
Binfloxacin
MBS5780087 Inquire

Binfloxacin

Sign In for Pricing
View Details
Bacteria-Derived S100A8 S100A9 Recombinant Protein C-6His Tag 50ug
IBCTS100A8RC6HIS50UG 50 µg

Bacteria-Derived S100A8 S100A9 Recombinant Protein C-6His Tag 50ug

Sign In for Pricing
View Details
Rabbit Polyclonal AP1GBP1 Antibody [Biotin]
NBP2-36531B 0.1 mL

Rabbit Polyclonal AP1GBP1 Antibody [Biotin]

Sign In for Pricing
View Details
HOXA1 Human shRNA Plasmid Kit (Locus ID 3198)
TG312367 1 Kit

HOXA1 Human shRNA Plasmid Kit (Locus ID 3198)

Sign In for Pricing
View Details
LB Agar (Lennox) Mix, 2kg
11-124 2 Kg/Unit

LB Agar (Lennox) Mix, 2kg

Sign In for Pricing
View Details