Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 9 (FGF9) . Accession Number: P31371; FGF9. Expression Region: 1-208aa. Tag Info: Tag-Free. Theoretical MW: 23.44kda. Target Synonyms: Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein is a purified Active Recombinant Protein.

Accession Number

P31371; FGF9

Expression Region

1-208aa

Host

E. coli

Target

Fibroblast growth factor 9 (FGF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHM3 CRISPR Activation Plasmid (m2)
sc-433811-ACT-2 20 µg

PLEKHM3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
HES5 Antibody
CSB-PA729212LA01HU-01 50 µg

HES5 Antibody

Sign In for Pricing
View Details
HES5 Antibody
CSB-PA729212LA01HU-02 100 µg

HES5 Antibody

Sign In for Pricing
View Details
AR Antibody
A76291-100UL 100 µL

AR Antibody

Sign In for Pricing
View Details
IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: LBI7G6]
AMM18049VCF 100 µg

IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: LBI7G6]

Sign In for Pricing
View Details
Junctional sarcoplasmic reticulum protein 1 (JSRP1) Bovine ELISA Kit
E4663 96 Tests

Junctional sarcoplasmic reticulum protein 1 (JSRP1) Bovine ELISA Kit

Sign In for Pricing
View Details